Elmeg CS410 Operations Instructions download pdf (Page 97)

s macro:

Programming macro buttons (»macro«

softkey)

Please select a function key first. First enter a

name for that macro (max. 20 characters.

Then enter the separate macro commands.

A macro’s command string is limited to 26

characters. Each command orbutton simula

tionconsistsoftwocharacters.Youcanthere

foreonlylinkamaximumof13commandsto

gether,or,forexample,join7 commands /key

stroke simulations with a further 12 digits.

Commands and keys for macro programming

A macro consists ofvarious commands,orecall flashbutton strokes, thatare compiledinto one command

sequence and stored under a defined direct dialing key. When thisfunction key is pressed, the individual

commands contained in the macro are executed one after the other.

The following commands are available for macro programming:

»B« Initiatingacall(sameasliftingthehandset)

»D« Endingacall(sameasreplacingthehandset)

»ELSE« Alternativecommand,ifarequiredcondition(e.g.»IFLA«or»IFLB«)isnotfulfilled.

»IFLA«

»IFLB«

ExecutethismacroonlywhentheLEDforthefirstlevelisoff(»IFLA«)orflashes(»IFLB«).

Ifthisconditionisnotfulfilledtheprocedureisdiscontinued,orresumedafterthecommand

»ELSE«(whereavailable).

»K« Keypadsequence;allofthefollowingcharacters/digitsaretransmittedasakeypadsequence.

»LA« DeactivateLED

»LB« TheLEDflashes

»LE« ActivateLED

»LZ« ActivateLEDfortwoseconds

»n« Dummynumber.

If a number is entered prior to execution of a macro (or for example, dialed from the tele

phone)thisnumberisusedinplaceofthedummynumberinthemacro.

»P« Pause(1second)inthecommandsequence(betweentwocharacters/commands)

»RE« Re-establishthephone’sidlestate.

Ifthereisanactiveconnectionatthisphone,executionofthismacroiscanceledatthispoint.

»SE« Activatingthespeaker(normalvolume)

»SA« Activatingthespeaker(lowvolume)

»T« DTMF-Sequenz:allofthefollowingcharacters/digitsaretransferredasDTMFdialing.

1 2 ... 92 93 94 95 96 97 98 99 100 101 102 ... 128 129

No comments

Elmeg CS410 Operations Instructions Page 97